DPCstruct | MC63799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423VKB0 | 205-292 | SVQTLVAQAVAELHLGRTEEAQSALDQALKKDPSYAEAIANALVLQAIIGKDTSELKETLKNTAPQHAFLTDLEEKSALFDTAASKFS |
| A0A482SVM0 | 1-98 | MVDKYGGTAVLLNGLAAAKMHLGLFDEAEVALKEALTKSPSDADSLANLIAVSFHLQRPQEVINRLLNQLKAKAPKHDLVVSLDNFE… |
| A0A4D9BBL9 | 498-589 | None |
| A0A2A6CZR5 | 193-286 | None |
| W7U2M0 | 22-137 | None |
| A0A180G7A4 | 206-314 | None |
| F4Q1V0 | 186-293 | None |
| A0A674H9V5 | 334-430 | None |
| A0A833ZLH8 | 102-198 | None |
| A0A176WJZ2 | 20-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.