DPCstruct | MC63798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3007 |
|---|---|
| Mean domain length (aa) | 266 ± 71 aa |
| Standard deviation of domain lengths | 70.57 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.32 |
| Pfam Score | 78.01 |
| Assigned Pfam label(s) | CL0110- PF04852- CL0219- CL0111- PF05699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353NMS3 | 27-271 | KKFIRWSPETSLESIGPLDVAEFKRYLQKQGQKPATINRALATLSTFFDWAVDKGLIENNPASNVKYVKEVETAPKSLFRREQLALM… |
| A0A8B6B4L2 | 7-207 | YAKQNAQRPKVRKNTETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFD… |
| A0A0F9NJ89 | 3-141 | None |
| A0A0F9NY90 | 42-241 | None |
| R6YJM5 | 455-725 | None |
| A0A834XZB2 | 11-330 | None |
| A0A1M3PCZ6 | 174-485 | None |
| A0A1P8WNT1 | 133-518 | None |
| A0A175Y4P8 | 724-1035 | None |
| A0A417KLW3 | 54-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.