DPCstruct | MC6379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 229 ± 26 aa |
| Standard deviation of domain lengths | 26.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T1AS28 | 31-260 | IYYWWWSFLRLSPVLWFAQETGIKPTDPQIAKVAESFGDLRTRYFDTWWRSTGRVIFAESKRPASVQLLALDQLHEHPFDPNKLYLE… |
| A0A1H3N1Q5 | 2-259 | WMEYLAISPSYERARRYRMGSLTDEQQQNLPADFDAVLSVYDDLGDVQRTDFKSWWQDRAMAVFGHEGVKPRVRRVDTLTTTYNKRA… |
| A0A2L0GHX2 | 5-227 | None |
| A0A3E1SFK0 | 5-249 | None |
| A0A5C7UI43 | 25-297 | None |
| A0A5B8DFC2 | 13-237 | None |
| H5T7Y4 | 36-278 | None |
| V7EJM0 | 55-271 | None |
| A0A7U5A6F9 | 2-214 | None |
| A0A258MH63 | 12-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.