DPCstruct | MC63785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2CU70 | 1-153 | MVTVEPQRSVVLEGENVPLVRIERVEGSTLSETVPVGTRRSDDLTMTLDGQPVRLAPAGGRLSRRSYRIDITHAGSRYRLQPNSFSG… |
| A0A4V2GI15 | 130-292 | ARRSAPGPHDGPVVVAVDRRLVRADVWAEGAPGTPAVRLRGEAGLTTEQVRTRNPPLTVTVAGRPAVLSVLDSSFRGLIAALRTVKV… |
| A0A1A9QEE2 | 40-199 | None |
| A0A163LEA1 | 2-176 | None |
| A0A059W2W1 | 91-260 | None |
| V8D4X5 | 16-144 | None |
| A0A1I3UMN1 | 1-177 | None |
| A0A286E9R3 | 126-292 | None |
| A0A2S5X255 | 25-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.