DPCstruct | MC63783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 389 |
|---|---|
| Mean domain length (aa) | 131 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.94 |
| Pfam Score | 78.03 |
| Assigned Pfam label(s) | CL0123- PF19934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2CBZ5 | 455-581 | GWVTNKNLAESLGVSERTVSAKVHKYRDGHPDWFLAYRGKKGRVFEHFHPDLIEIVSSEIKEFERAPEGWMPNGRLAHEIHRGTETI… |
| A0A1H1H643 | 5-118 | DFITLTRAGRILSRDPRTVASMIRRGELAAFEVAGRRVVKESDVRALLNPVPVATQRLSLSPSRAGKRLGMSTSTVTRRVHDGELAG… |
| A0A1H1TR85 | 296-454 | None |
| A0A254Q5D6 | 1-104 | None |
| A0A6M5F9G2 | 1-198 | None |
| A0A5K7XGY5 | 8-141 | None |
| A0A1Y5R7N7 | 441-550 | None |
| A0A5C8SMH6 | 699-830 | None |
| A0A2W1UPB4 | 13-151 | None |
| A0A1Q9PTP7 | 363-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.