DPCstruct | MC63774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 201 ± 26 aa |
| Standard deviation of domain lengths | 26.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D5AHW2 | 2-227 | PYHDTLEHLLEECELANARLEAFRERATSRFTRDGLSMDEADGVGEPVASAATLEYALPERDRDRFRERRDRIERKCNAAHEQGVEL… |
| A0A4Q3LRG8 | 5-179 | QQNLTALNQELDWLSAVISQAITSYLLHDGHEHDWQNITLPVVSEESAFGNFVIKQQLDIYSRLALALAVAPQLKPQSLDIFFSKNQ… |
| A1ZUT2 | 83-259 | None |
| A0A514BYH7 | 15-183 | None |
| A0A251WB84 | 1-250 | None |
| A0A538PF86 | 427-634 | None |
| A0A2N0KBF2 | 4-202 | None |
| A0A7V3W1K0 | 1-200 | None |
| D2VBG8 | 276-470 | None |
| A0A7Y5HGX5 | 3-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.