DPCstruct | MC63770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF08180- PF17804 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C9HP92 | 2-112 | RIAYVFLGAFLAIAQSAYAEVASPPVLAPLKRQAQAAELSAQFLSRYSYKPVPLDDALSARIMDGFIKSLDPDRMLFLQADIDRFMS… |
| A0A3S4FSD2 | 13-90 | LKEETQHATVSERVTSRFTRSHYRQFDLDEAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTVLGDELRTGKLDVF |
| A0A5C2LJA5 | 1-83 | None |
| A0A7X9KCA6 | 1-118 | None |
| A0A378AW20 | 5-118 | None |
| C2G0Y9 | 2-124 | None |
| A0A090ST30 | 2-138 | None |
| A0A6M1Q2J0 | 11-124 | None |
| A0A379S3G6 | 13-90 | None |
| A0A7Y1T7X3 | 23-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.