DPCstruct | MC6376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 150 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849I1I7 | 3-153 | PKTSPQHYLTGMTALNIPCPDEGYGDWHFYEAFFGRGDIQPKIFVAGKGEKWNTLPLFGDFGIYECSHILREHGVPLAENEKVYAAG… |
| A0A519BH29 | 1-137 | MEKENIKYITGFGALNITGADWHILDNIRTGNWPISGVDYADTTGLFGNARLVSSGDFSKSLGSNIKNIKCASPARAIADMLYHNIF… |
| A0A1H2G291 | 9-162 | None |
| A0A2T4DWU1 | 68-202 | None |
| A0A6B1C595 | 66-220 | None |
| A0A1H4GRH6 | 54-197 | None |
| A0A7T9CAJ0 | 14-179 | None |
| A0A660QGT9 | 202-338 | None |
| N8YKC9 | 9-167 | None |
| A0A6L8HYR2 | 32-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.