DPCstruct | MC63756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1MJN9 | 110-242 | FFEVHMEPSNANDDTFDALTEFVNLADRYNVKLTLLFTPQWAEMILKDSKKLGLLDQWKQDGHGIGGHHHGPSTCPWDGYTNLDPNS… |
| A0A7C3B556 | 1-150 | MPHYFLAIHNEPFHDTPMQQEKLESSFVLLGQMVEQASKYHIKLILIFTAQWAEFIASDPEKMVELASWQQNGHEIAANHRSIYHGG… |
| Q64C42 | 206-326 | None |
| Q64C45 | 67-199 | None |
| A0A519CW47 | 64-182 | None |
| A0A2V2MUM0 | 64-191 | None |
| A0A7R6WCV8 | 71-199 | None |
| A0A7C3LDB3 | 435-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.