DPCstruct | MC6375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 147 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519BFN3 | 317-484 | NLCVFTPGRFSEKCAMKIFTDLPEEYFIEIGDFVSYSVRKAADFGIKNIILTGQFGKIVKISQGERNTNAKYSRLNLNYIGEIIKNS… |
| A0A6V8PGZ3 | 1-95 | KIAAGIFNTHSKFGDARLETIAAYAGLCGADPEVIKDILSQNLAEATVEILRKNGLLSCFDEIARKIVLRASEFVDNQLKISCILLS… |
| A0A843GAA9 | 41-191 | None |
| R6RXV6 | 2-116 | None |
| A0A7G8C8G0 | 193-338 | None |
| Q1NN74 | 127-294 | None |
| A0A7X8A8R5 | 3-169 | None |
| A0A7V2T942 | 6-138 | None |
| F1YVW5 | 104-246 | None |
| A0A3A9FNN8 | 473-637 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.