DPCstruct | MC6374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 274 ± 44 aa |
| Standard deviation of domain lengths | 43.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18838 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1E3R1 | 1-215 | MSYIGIIGAKRLDDSNASLGLIEAQKKAVQLLRCSTDMHMIKQQTGWEMGVDGKWRYEVADPFHNTVEIEDHLKRHFGESINISLCM… |
| A0A1I5PC38 | 104-363 | YRQGIEDLMDAGVRTHKSGQLNIFAGPGAANADRSALSRAEQMEQAGVDRDHIWRSTGWGRGVDDQWRFEIDDSAARVGLRPGETAP… |
| A0A1X9SW42 | 405-699 | None |
| A0A1G0B2T1 | 237-487 | None |
| A0A2E9KRF2 | 29-265 | None |
| A0A1Q2LID9 | 424-644 | None |
| A0A6D2C2V1 | 169-481 | None |
| A0A661E6R7 | 73-404 | None |
| A0A374UIX0 | 238-484 | None |
| A0A496XJI0 | 27-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.