DPCstruct | MC63735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832UTB5 | 1-162 | MINIQPRLVNLQEPAAPKGSVVFAYGFRPFFILAGGWGMLSMVLWLMILYGPLNSAGSLPTSWWHGHEMLFGFVAAAAAGFLLTAVT… |
| A0A0A0BIR8 | 16-142 | FLDLAFRPFFLLATLFSIFALCLWGLLLSGRLVFSPYGGGYFWHAHEMVFGFVSAVLVGFLLTAAQSWTGVRAPNGFKLFVLACVWL… |
| A0A1E3VPX7 | 1-139 | None |
| A0A1I1RP78 | 10-154 | None |
| A0A090P2S3 | 1-153 | None |
| A0A501WCA2 | 1-161 | None |
| A0A483AL04 | 13-153 | None |
| G3ABX2 | 8-139 | None |
| A0A1G2WZ28 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.