DPCstruct | MC63726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 59 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L4G4 | 1-63 | MASHVLQMPITVYMREEAAGGLIAIAEYGQEYGKEDPIRVLYHGCGHYEALHIPGNSEPRSRL |
| A9U337 | 113-161 | SHVLQMPITVYMKDKGGIISIAEYGQEYGNDDPVRVLYHGFGHYEALHL |
| A0A835HDH2 | 1004-1066 | None |
| A0A4Y1QYV8 | 120-172 | None |
| A0A6S7NFQ7 | 245-335 | None |
| A0A287SMV7 | 1-55 | None |
| M1CGB3 | 37-91 | None |
| A0A6P6V6N1 | 65-111 | None |
| A0A2P6TB47 | 85-160 | None |
| A0A446NXE9 | 779-825 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.