DPCstruct | MC63725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 67 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 71.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L1W9 | 1-56 | MESLHIPKGVQRVLFRTLNTDRNLMWKKEFDTSYVGFMKDGAQWLVDNTDIKLVGI |
| A0A7G2F8C4 | 392-474 | KSLHIPKGVSRVLFRTLNTDRRLMFKKEFDTSYVGFMKDGAQWLVDNTDIKLVGIDYLSVAAYDDLIPSHLVFLKDRETILVE |
| A0A438FNC6 | 1-55 | None |
| A0A6A6N266 | 297-373 | None |
| A0A7S0WK21 | 123-193 | None |
| A0A6A3AV24 | 705-799 | None |
| A0A6A6L013 | 292-353 | None |
| A0A164VP71 | 142-211 | None |
| A0A2G3CNX5 | 147-231 | None |
| A0A453L1W4 | 2-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.