DPCstruct | MC63724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 14.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L174 | 1-172 | MLQSLEWEPTGSYQIAVKELTENGTMSDQSGPSGLIDIHLSTEISDGNLPSNPQRAIIYHPTVSHLMAVLATICEELSQDSILLIYI… |
| A0A6I9YKV1 | 106-261 | MLQALEREPMNLATQMNKPGLQETTEKPARRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPSGRSDSEGPYDF… |
| A0A803Q4A2 | 399-552 | None |
| A0A5J5BZX6 | 3-145 | None |
| A0A819ICU8 | 647-824 | None |
| A0A7J7DT09 | 171-350 | None |
| A0A6V7P649 | 618-766 | None |
| A0A453L190 | 139-285 | None |
| H9GJK1 | 223-375 | None |
| L9JDX3 | 207-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.