DPCstruct | MC63722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 187 ± 23 aa |
| Standard deviation of domain lengths | 22.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 59.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2K525 | 56-206 | YDPELRVVLELATDEELYELQRILFGPSYFSPLLKSILNKDDVEDMMIEENVEERDAFIAGLESRFLFLAADARSTLRGWRPSYRNV… |
| A0A067DXV5 | 60-234 | DPELRSVLELATDSELYELERILFGPSYFSPLLKSFTKRADVDYVMIEQDLEEREDFIASLESRFLFLAADARSTLRGWRPSYRNVL… |
| A0A453KYK8 | 84-267 | None |
| A0A0K9RDT9 | 99-317 | None |
| A0A287RLG8 | 1-192 | None |
| A0A6P6XCW5 | 79-295 | None |
| A0A2P2KJM8 | 56-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.