DPCstruct | MC63721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 62.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183GL61 | 110-214 | LHLTGDIHAITAANNLLAAAIEARMFHESTQKDDALFNRLCPANKQGKRPLSAVQKRRLARLGIPDVDDANQLTPEQRVQFSRLNID… |
| B9T080 | 6-145 | LHLTGDIHAITAANNLLAAAIDTRIFHESTQSDKALLNRLCPPNKEGRRSFSDIMFRRLKKLGISKTKPEDLIAQEVKKFARLDIDP… |
| A0A2P4YIN4 | 138-238 | None |
| A0A1A6H879 | 160-272 | None |
| E2LTZ6 | 385-538 | None |
| A0A0C2BRW9 | 142-278 | None |
| A0A2Y9HAM6 | 477-605 | None |
| A0A183U1K5 | 291-393 | None |
| A0A425DER6 | 107-242 | None |
| A0A7J7EHB3 | 243-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.