DPCstruct | MC63716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 231 ± 35 aa |
| Standard deviation of domain lengths | 35.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KS19 | 5-236 | TSIFDLHRSCPNCSYELCIACCKELRENNLKGSCREELVSYPHRGIDYMHGGDPSPELMNCVQTDLSSCQPKTTKWCANTDGTINCP… |
| A0A446QFY8 | 158-365 | DARCYCNYCRTCIVDLYRGCECGHYDLCLSCCQELRDGSLVKKDKKLRAKPNGSILCPPKAAGGCRCRGHALKLKGIFKENFISDLL… |
| A0A438DKW3 | 304-552 | None |
| A0A1U8P1N7 | 2-194 | None |
| A0A1U8NNU2 | 15-254 | None |
| A0A4Y7LDT4 | 18-237 | None |
| A0A0A9DHT5 | 1-212 | None |
| A0A2K3P1A2 | 275-529 | None |
| A0A7J0E8F6 | 395-640 | None |
| A0A7J7MEQ1 | 529-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.