DPCstruct | MC63715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 247 ± 51 aa |
| Standard deviation of domain lengths | 51.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.45 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | PF08082- PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KQ92 | 1-201 | MWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNLLDVEPLEAIQLELDPEEDGAVYKWFYDHKPLVKTKLINGPSYRKWHLSLPI… |
| A0A3P7EFR5 | 2-267 | PHAVLKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPRVIEPVYMAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNI… |
| K0TGJ8 | 349-709 | None |
| B8C3V5 | 550-888 | None |
| A0A512UK03 | 169-449 | None |
| S9UW48 | 92-374 | None |
| U6LXD5 | 21-285 | None |
| J9E1P4 | 1-202 | None |
| A0A2S4VAW8 | 1-160 | None |
| A0A0C2ZSK1 | 6-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.