DPCstruct | MC63714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 230 ± 31 aa |
| Standard deviation of domain lengths | 31.27 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KNX1 | 10-272 | FLTQANALLRKNLCLQKRNLKTNIGITIFPILICVLLLVLQNIINNELDKPKYNCGCACVDTDMYGTCRKRECGVQYSTLEQVWSCA… |
| A0A452ZL87 | 2-196 | NVCITLFPILLCVLLVLLQGAIDREIDKPKYRCGCACVDAAADGSCRRTECGVQHSTLDQVASCPIPTPPRWPALVQLPTPEARAIS… |
| A0A7J7MLD0 | 2-212 | None |
| A0A2Z6NZZ3 | 1-208 | None |
| A0A1D6QQL9 | 6-273 | None |
| A0A396IFS1 | 5-257 | None |
| A0A068V2F5 | 24-257 | None |
| A0A5P1FBM2 | 33-291 | None |
| A0A816MYJ0 | 5-255 | None |
| A0A287X6B7 | 6-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.