DPCstruct | MC63709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 148 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 54.98 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | PF15628- PF15629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KI95 | 1-146 | NYMQVNNIEMEDADMSSALVAITPEAASIPTPRLKNVSRLRTEHQVYELPDSHPLLEGYDQREPDDPCPYLLSIWTPGETAQSIDAP… |
| B8A274 | 269-423 | NVEIEYADMSKALVAITPDAASIPTPKLKNVNRLRTEHQVYELPDSHPLLEGFEQREPDDPCPYLLSIWTPGETAQSIDAPKTFCDS… |
| A0A1D6QN83 | 1672-1827 | None |
| A0A835U6Y5 | 429-583 | None |
| A0A2G2WUX1 | 422-568 | None |
| A0A061GZS9 | 137-290 | None |
| A0A1S4BZ82 | 203-312 | None |
| A0A6A5NB05 | 823-965 | None |
| Q9SJQ6 | 1166-1306 | None |
| A0A1R3H6T6 | 389-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.