DPCstruct | MC63702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 230 ± 25 aa |
| Standard deviation of domain lengths | 24.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A129SJ86 | 32-235 | SVLMNQLIKNGDEFVEIDIKAAQYQGREWLIECKGAANSSYLILIKEDNSNDPKLYNTRRHVIKDSNYRVAQFKPDENQCFFTFTGD… |
| A0A0A2V826 | 43-280 | VQEEWSYRDRDSSGLRTLDVLASRILCDIEAHQPRARPELNLLIECKRSELPFVFFATRHRPDLENFPMIAGLRANNLHVFTDDDLS… |
| A0A4S8Q4S2 | 53-296 | None |
| A0A6M8WBX2 | 1-202 | None |
| A0A2M9AR93 | 8-213 | None |
| A0A5R4SJY5 | 1-274 | None |
| A0A5B9MLD0 | 8-254 | None |
| A0A1C9VDK0 | 2-193 | None |
| A0A240U4V8 | 416-648 | None |
| A0A1F5WQB4 | 30-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.