DPCstruct | MC63701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A095B2Z4 | 20-146 | AATSEPPPIKVIDRYDHISTGFVLDGRHAEIGCDTCHAKAVFRGTPRTCAACHNNVRAEGKTFRHIPTTDACESCHTTKDWLTARFD… |
| A0A257KV99 | 102-224 | TFDHAQSDYLLRGKHSEVKCNACHLAGKKFRQAPQDCVGCHRKDDKHKAHFGEACDSCHNVRDWRLWRFDHQRQTDYPLETGHAPVA… |
| Q605T7 | 257-371 | None |
| A0A3E1R8L6 | 37-161 | None |
| A0A7C3KI86 | 472-587 | None |
| A0A7Y5G9I5 | 68-176 | None |
| A0A5C7RST2 | 433-588 | None |
| A0A845TVP1 | 205-319 | None |
| A0A3D5SUR5 | 1-128 | None |
| A0A2E5HL46 | 95-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.