DPCstruct | MC637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02325 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538JUW9 | 7-112 | HWILTAGKIVAGFVYGVVLSFLVILTMAFSLRLLGANPATDFTEWIYRSAGRIMEPFRGIFPATQVSDRSVFDASLLFGMIAYSIAA… |
| A0A7C2TEE6 | 32-104 | NYIWLIIGTLEVLFGLRFLLKLIAANPVAPFARLVYNFSYLFLRPFDGLAASPLVDGIILEVPTLIAMFVYAL |
| A0A7X1PD00 | 1-94 | None |
| A0A536DC70 | 160-266 | None |
| A0A1F7G863 | 3-82 | None |
| A0A1Q7HLZ0 | 8-106 | None |
| A0A1F6FPB2 | 7-100 | None |
| A0A2N2LXF2 | 18-115 | None |
| A0A4R7I7A2 | 37-138 | None |
| A0A7V2JRN1 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.