DPCstruct | MC63699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3594 |
|---|---|
| Mean domain length (aa) | 187 ± 34 aa |
| Standard deviation of domain lengths | 34.08 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 13.19 |
| Pfam Score | 96.66 |
| Assigned Pfam label(s) | CL0055- PF02672- PF01018- PF11957- PF00719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091DLA9 | 21-215 | GKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGKEKLRLDEAGVTDEVMDSAMQAFILEVIAKHGEP… |
| A0A7D9H3R2 | 3-176 | PSDHLIFIGGPSGTGKTTIATLLAQRLNGHYIEGDEYHPKANIDKMANGIPLTDEDRWPWLKKLNQVAVSSFSDMKFETDERYIIVS… |
| A0A6A0JSV7 | 2-171 | None |
| A0A1N7EE05 | 2-161 | None |
| A0A4Z0YTK4 | 14-212 | None |
| A0A2I2YSL8 | 101-236 | None |
| A0A0F9P1C9 | 8-210 | None |
| A0A537ZHG4 | 5-168 | None |
| A0A538A2J7 | 7-154 | None |
| A0A351I961 | 734-956 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.