DPCstruct | MC63692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839T0L9 | 1-55 | MEFDVISQDPTKPQYRQDSTLGEDHKHWFRAKFFQQYRLFFRYHGPSKVIVFWLG |
| A0A3B1AJJ6 | 34-101 | KQLAAIRKLIFENIPADPANPEFRQGNTLGKKYKHWFRAKFFQQYRLFFRYHAATKIIVYVWVNDDKT |
| A0A838NY19 | 20-88 | None |
| A0A6N9EQ17 | 22-74 | None |
| A0A521YB11 | 19-73 | None |
| A0A6L8GNV2 | 22-74 | None |
| A0A2J7YIH1 | 1-65 | None |
| A0A2W1JHT0 | 4-64 | None |
| A0A257ZXB5 | 43-104 | None |
| A0A5E8G5R8 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.