DPCstruct | MC63691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839T094 | 10-103 | PTPEEDADINAGIAQDPDNPELIDENFKRMRPASEIFPEMVMAHIESKKGRGPQKTPTKERITIRLDSDITEYFRSYGDGWQSKLNQ… |
| A0A2J6MTW3 | 3-78 | TAEEEAAIQHGIDADPDTYVPGDEEFARMKRRGRPRADTPKVLLSVRYDADVVEAFKATGDGWQTRMNAALKDWLK |
| A0A7C1RFR6 | 25-98 | None |
| A0A5C8SWT3 | 4-110 | None |
| A0A4Q3NSS8 | 1-82 | None |
| A0A377I1H3 | 1-102 | None |
| A0A3N0UZB6 | 3-79 | None |
| A0A068YQ18 | 16-93 | None |
| A0A515DAP9 | 9-87 | None |
| A0A3S0D2T1 | 37-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.