DPCstruct | MC63673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 145 ± 19 aa |
| Standard deviation of domain lengths | 19.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495MYL7 | 18-190 | VAAPGPAVWLLGAHGGAGVSTLARYWDFAEDARHQWPCGDARETESPYVVVVCRETIQGLSSAHDLILEHRNRGLACELLGLVTVAN… |
| A0A2N7S1J6 | 2-134 | GLHGGAGASTLASLLGDGASEVGQAWPISQNAWTGSAWPIPVIAVARTDHSGLATADRFVRSWANGQLTGSQLSALVLIEAGPRTSD… |
| A0A6N9VSX6 | 16-141 | None |
| W8HBN6 | 5-154 | None |
| A0A1R4IZ64 | 30-182 | None |
| A0A853DQY9 | 45-207 | None |
| A0A1Q9SJV1 | 1-141 | None |
| A0A7W5VCX2 | 10-117 | None |
| A0A1Q8XG01 | 38-198 | None |
| A0A2A3HVH1 | 51-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.