DPCstruct | MC63670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.72 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF11267- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0Z4D4 | 7-119 | RLSRTFETPSISGQELRDLIVEKWGRSYDTRLHKRGQRMYLQIMWKFLEQRSFHLNENEYQAQLDAVAEYLTLWRVGPTVRAAIRSA… |
| C1MRS7 | 1-103 | MTGEELRMLVLNKWGKMYDTRIHQRRDQFNKLGLYLQIMWKHVGQKSFPMTEQQYVEQLSAVAELLTEWGAQDVVRQKLPQSTKFPK… |
| A0A7R9Y456 | 8-126 | None |
| A0A0A2BJX6 | 40-138 | None |
| B8C2G8 | 149-280 | None |
| A0A118JXQ8 | 69-241 | None |
| A0A383VWH4 | 181-306 | None |
| A0A835Y757 | 17-163 | None |
| A0A5B8MIM6 | 95-210 | None |
| A0A835IRX7 | 143-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.