DPCstruct | MC6367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Standard deviation of domain lengths | 22.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 33.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1Y6F7 | 84-282 | GTTLKEGIIKYSAGHYLAGTPIPVGFDAFGYNYQARMFKGSYANAYLGGIGYPPYDGNDVEYLKKNPNAKVHWAWPYRNVKLEMKWN… |
| A0A1F6I7S3 | 13-169 | IIILGVVTLIAVLGIATVSAAGGFDQFGYNYGANVFVGTGSSWCQGKFGLDKPTCDASMAPFQNDKLVMKWSKAWDDAVFGPDGIRE… |
| A0A2M7IEM0 | 16-187 | None |
| A0A1F7X6M6 | 8-150 | None |
| A0A3B0TB65 | 11-139 | None |
| A0A7J3CUU0 | 32-206 | None |
| A0A7J2NJE5 | 197-330 | None |
| A0A523SC37 | 1-180 | None |
| A0A0F9LF89 | 6-152 | None |
| A0A0G1JXU8 | 68-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.