DPCstruct | MC63669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 168 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.60 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF05981- PF16166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4RNE6 | 3-155 | NPQISTQDRSFGALIYLFPLVYALPFGIPLLSQFPPLAQFFSPLITLYRLTNSLPFASLIIFFGLWLGVVRNENVSYFLRYNAMQAI… |
| I0Z0D6 | 143-299 | AAVPTGNRGPPSLLVRLASAFLYIVPWIDILTLGREIYHFFPTSLLLYLVPGPLAPLYYSGQFVPLIVFFLLFLAIVKNNKLHHFVR… |
| A0A540MBR0 | 278-457 | None |
| A0A7R9Y4P9 | 66-258 | None |
| A0A1Q9E7B6 | 590-733 | None |
| A0A6A2XKM2 | 35-222 | None |
| A0A444XAE6 | 421-634 | None |
| L0AY35 | 738-928 | None |
| A0A343KP80 | 6-166 | None |
| A0A7J7IDD5 | 53-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.