DPCstruct | MC63666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 135 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15247 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7FR81 | 2-71 | TETDESILQRRQKQIDYGKNTLGYQNFLQVVPKAARQPGIHPRTPNKYKKYSRRSWDMQVKLWRRALHAW |
| I0YLX7 | 7-160 | QNDTTEKFVVDQENTAQNATRETDPHRLEQRLRQITYGKNTLGYASYTKAVPKDKRKRAKKGEENTHPVTPDIHQMCSKRAFDGQVR… |
| A0A1D2N7B6 | 2-120 | None |
| A0A0J9SDS3 | 1-121 | None |
| A0A7S3LVU9 | 19-156 | None |
| Q5CXD3 | 256-367 | None |
| A0A6G0XY66 | 4-129 | None |
| A0A5S6QNG1 | 204-360 | None |
| A0A0N1IBE7 | 455-693 | None |
| A0A814TRV5 | 9-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.