DPCstruct | MC63665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 242 ± 40 aa |
| Standard deviation of domain lengths | 39.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0YKD5 | 8-238 | FALRVSCATPVLGPALGMSGIGLSSILAGEASRRFGSHLRGETRRHRSAQAVAQDAALDAIMGITLFKLMGGRFRNLMPSSLLRPGA… |
| A0A835YVL4 | 2-225 | ALNLSQAVQGAVLRVAASTPLGIPNALGFVTVAGASLVALHVSEAVSTALTTGNLQLAVQSTIETASDPGPAEASAVAFGLALFKCL… |
| A0A0C2J8C2 | 20-217 | None |
| A0A7S0YJE1 | 255-452 | None |
| L1LFZ1 | 41-328 | None |
| A0A2K1JC45 | 47-283 | None |
| A8JAN1 | 17-234 | None |
| A0A2C6LAY4 | 218-505 | None |
| A0A829XGU4 | 3-215 | None |
| H3HDH8 | 63-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.