DPCstruct | MC63650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 234 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 47.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RZY5 | 5-203 | GRCNIKVSVDIPVDTELATPLVESCIWRQVRGSGAGISESDAQDTTSEKVGIAQQWYDEIDNLAFSEAAEEPAVIKGDDKPADESHQ… |
| A0A3N7G4H5 | 1-191 | MDTELVEPLQEGCIWRQARGSATVILGAEDVVGSSEKAGVSQQWYDELDNLAFSTPGLEMATEEDSATSDVNYQDERLHIDCAVNTS… |
| A0A2I0WG76 | 71-272 | None |
| A0A0A9N4F7 | 58-301 | None |
| A0A287WW25 | 92-335 | None |
| A0A0E0LQY9 | 404-647 | None |
| A0A4D9AKS0 | 392-646 | None |
| A0A5P1EIF2 | 505-749 | None |
| A0A6N2N3Z4 | 132-381 | None |
| V7AKC5 | 253-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.