DPCstruct | MC63643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RRP1 | 4-85 | IRRGHQVYQQVCASCHSMSLISYRDLVGVAYTEEETKAMAAEIEVVDGPNDEGEMFTRPGKLSDRFPQPYPNEQAARFANGG |
| A0A813BVD5 | 1-84 | VYKEVCASCHSLNRIAYRNLVDVCFSEKEAKHLAAQIEVTDGPDDTGEMFERPGKLSDYFPAPYANEEQARAINNGAYPPDLSL |
| A0A5J5U4S7 | 48-140 | None |
| A0A443NYB3 | 6-88 | None |
| A0A090MNH0 | 453-530 | None |
| A0A066W1F8 | 135-223 | None |
| E9G9E0 | 41-128 | None |
| G6F0W2 | 1-66 | None |
| A0A3P6RSG5 | 13-87 | None |
| A0A059APG2 | 212-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.