DPCstruct | MC63641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 44 ± 3 aa |
| Standard deviation of domain lengths | 3.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 92.27 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF00223- PF02788- PF05695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RI95 | 1-43 | PLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLTFRG |
| A0A444ZBV9 | 148-190 | PLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRG |
| A0A1R3KZI6 | 42-84 | None |
| A0A2G3CRL2 | 71-113 | None |
| A0A6P5MEV9 | 235-284 | None |
| A0A2G3ASB3 | 208-250 | None |
| A0A0B2PS33 | 151-200 | None |
| A0A4S8I2Y4 | 235-277 | None |
| B9RTD2 | 152-198 | None |
| B9RX98 | 42-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.