DPCstruct | MC63640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RHR7 | 1-91 | MDCSILKIWNLNAHSGVIGAFNCQGAGWCREGKKNLIHDVQPGTITGAVRGRDVSRLQEVAGDGWNGDVVVYSHVAGKASFNQNQRV… |
| A0A6A3AFN6 | 532-639 | GRPTVDCLFVDPARDGISLLKMWNVNKCSGVVGVFNCQGAGWCKISKKTRIHDASPDTLTGSVCANDVDSITQIAGADWNGETVVYA… |
| A0A6A6MKN7 | 309-399 | None |
| A0A4D6MPM3 | 541-647 | None |
| A0A7J7N5A9 | 1-115 | None |
| A0A2Z6MWQ6 | 306-412 | None |
| A0A317Y6M9 | 273-360 | None |
| A0A445AAQ5 | 551-655 | None |
| A0A7J6X146 | 959-1067 | None |
| A0A388K2K3 | 946-1054 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.