DPCstruct | MC6364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.18 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0179- CL0167- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4J5Y6 | 30-109 | YLKRIDLDQDLVEQGPFDLIIHKSIDLFVQSIYFDNKKACDQLNKFQSYIKNNPQIPISNPLNFDYLVISRKRIFNELKK |
| A0A1Y2CCI2 | 16-99 | NLDIPVESQGPYDCIIHKITDLIAKAENGDLIVKKQVDNFKNYVNNNPTVPIVDPLDVVCKLMDRITANDLLEKVRTMEMKMEK |
| A0A455AWS2 | 1-76 | None |
| M7BVP1 | 119-197 | None |
| A0A3M0JD70 | 188-266 | None |
| A0A6F9CH31 | 152-229 | None |
| A0A5B7DV61 | 2-76 | None |
| A0A6F9CIS8 | 28-101 | None |
| A0A6G1SJ86 | 46-118 | None |
| L5LMP1 | 266-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.