DPCstruct | MC63635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 199 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RDS4 | 5-169 | QRLRPIQIWDWLFRSCEINGRILLSEGLISSEDIEEFITKGKGKKLSIKLPAWCILHCLIRSAKHDTHGLLISDDVEVTNFNWPKDK… |
| A0A453RE27 | 6-185 | RLRPIQIWDWLFRSCEINGRILLSEGLISSEDIEEFITKGKGKKLSIKLPAWCILHCLIRSAKHDTHGLLISDDVEVTNFNWPKDKV… |
| A0A7S2UZ41 | 64-262 | None |
| A0A067JJI9 | 310-472 | None |
| A0A7S2HFG4 | 18-215 | None |
| A0A834ZJX4 | 899-1110 | None |
| A0A812LI23 | 206-403 | None |
| A0A7S2E767 | 444-647 | None |
| A0A218XL61 | 22-193 | None |
| A0A6N2MBL8 | 15-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.