DPCstruct | MC63634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 126 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 63.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RDK7 | 1-126 | MWLAGCRRCPRSYHLDCLPREICFKYGNGGIRAWFLSERNLSKRLIIYCTDHEIDPAMGTPCRDHIKFPALLENKGHGSTESTKFQH… |
| A0A453KCS1 | 1-143 | MQFAVCRRCPTVYHRKCLPRDISLIEDEEEATPQRAWDGILPDQILIYCRKHEIQEELGTPKRDHIVFPDVRNPGAAERHRGAPQRH… |
| A0A0K9R2P0 | 105-230 | None |
| A0A2R6QT91 | 368-487 | None |
| A0A6A1UJS0 | 308-429 | None |
| A0A7J6VIV7 | 70-195 | None |
| A0A811M4C6 | 67-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.