DPCstruct | MC63633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 75.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8TG36 | 349-410 | SKLRVKQLEWDISFHIGRQEAKLALRVNCAAYNGDFYQLKILIRAGADPNKTDYDGRSPLHL |
| A0A6P3Z6V8 | 98-173 | LRVKQLESDITFHIGKQEAELALKVNSAAYYGDLYQLKGLIRAGADPNKTDYDGRSPLHLAASRGYEDICYFLIQE |
| A0A803P7U2 | 235-312 | None |
| A0A2P6QZJ9 | 91-148 | None |
| A0A6A6L5E6 | 271-349 | None |
| A0A453R9J0 | 76-136 | None |
| A0A453R9J4 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.