DPCstruct | MC63632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 58.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453R9L8 | 9-70 | VKTIQQGKHGSDTDVYDIQGRFVPEKFEEIFKKHAHTRPDALTDKELGEMLKANRDPKDFSG |
| A0A061EME7 | 241-310 | PNLLFPIYIDNIHKAKHGSDSATYDTEGRFMPVNLENIFSKYARTEPDKLSFEELWRMTEANRLAFDFAG |
| A0A834TVT6 | 2-58 | None |
| A0A453PID0 | 9-68 | None |
| A0A0D9VRD1 | 654-715 | None |
| B6TWY2 | 112-171 | None |
| A0A3L6PDN3 | 289-358 | None |
| A0A2U1PSY4 | 454-521 | None |
| A0A1E5VNQ5 | 69-136 | None |
| A0A5N5L5Z8 | 479-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.