DPCstruct | MC63623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2SDE7 | 1-85 | MANKIESRISYKTLFNDNQDLYCFPNLPEANDGPLAYLVDLYQQVRLFESVADKDGSLFLSQRRPDIDKLLLDSPKIKQKMMFSI |
| A0A2S8Q5F6 | 1-98 | MANKIESRINYKTLFNDNQDLYCFPGLPEANDGPLAYLVDLYQQSCLFEEDADKKSARLLSQRRPDIEKLLLDGANLNQTSQSLPLV… |
| A0A3M3ZFI0 | 6-90 | None |
| A0A1T2Y4V4 | 83-186 | None |
| A0A2D0KYY1 | 1-86 | None |
| A0A3M4L2W0 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.