DPCstruct | MC6362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183D446 | 8-155 | DPDALMGDLNTYVKNLREMVKLKDVYQCAMSYNDYQEQTVESICYLILERVRNVQLIKRNLDEYARPYMEEYKLDPDRTLYNYTAKI… |
| A0A1Y2BMV9 | 39-179 | IFKNKTTIEFTEENKLKHQLQDLVYLWDVHHYKISLEKYDQSEPEGIAFDMLDKVVASELLDKTIKEHFIPYVNKNNINKDKLLYEY… |
| A0A6P8W9G9 | 30-204 | None |
| A0A6G0XV54 | 36-181 | None |
| A0A044QWP1 | 740-893 | None |
| A0A6V7XC44 | 196-377 | None |
| A0A7R9P9X7 | 340-494 | None |
| A0A7E4ZTC9 | 3-147 | None |
| A0A183DWA8 | 323-509 | None |
| A0A1I7ZKP3 | 9-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.