DPCstruct | MC63613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 361 |
|---|---|
| Mean domain length (aa) | 183 ± 37 aa |
| Standard deviation of domain lengths | 37.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.49 |
| Pfam Score | 85.44 |
| Assigned Pfam label(s) | CL0063- PF03453- PF01969- PF03454- PF00994 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9PX68 | 2-203 | KAEIITIGDEILIGQIIDTNSAWIANELNLIGIDVCRMISIADQADEIIRAVDDSFQRVDVIVMTGGLGPTSDDKTKQVLCDYFQTH… |
| A0A7J4QY18 | 6-125 | PLEVHYRCIPDKQSLIESTMIELADVVGCHVVVTTGGTGPADRDVTPEATENVVERLMPGFGEQMRAISLKYTPTAILSRQTAGIRG… |
| A0A6J0ZU03 | 227-451 | None |
| A0A7R9SZ06 | 138-325 | None |
| A0A5S6Q4Q2 | 188-363 | None |
| A0A7R9KQT6 | 77-260 | None |
| A0A2R4ZQ78 | 1-200 | None |
| A0A369KQ16 | 3-210 | None |
| A0A662U1Z8 | 187-392 | None |
| A0A7M3RTZ9 | 20-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.