DPCstruct | MC6361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 437 ± 78 aa |
| Standard deviation of domain lengths | 78.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2BIN8 | 92-491 | PDSDGQYLIYDGSSNYLFIRTIANAFTIVSIAATNIQETDVYGINASNGALINLGTATDDVLQANIEEMTLYYCEATDHTCTRTYGY… |
| A0A1Y1ZW47 | 9-293 | PNPVVSVEGGLSLYTCSVVKCVQTFGFIKSGANYYAIPKTGASSKKSAVDGATCDSSIGLLFTDYKLCVSEDEEEVVEFITTATSTN… |
| A0A1Y3NPW0 | 23-491 | None |
| A0A1Y3NM01 | 186-514 | None |
| A0A1Y1UZI9 | 1-509 | None |
| A0A1Y1UW60 | 688-1254 | None |
| A0A1Y1WYR2 | 1-300 | None |
| A0A1Y1WRI8 | 24-494 | None |
| A0A1Y1VSF8 | 468-914 | None |
| A0A1Y2B5L6 | 45-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.