DPCstruct | MC63608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 25 aa |
| Standard deviation of domain lengths | 25.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9JTX9 | 1-126 | GTGEALVTALNEKGIPTPLAATMLRTPMSRMDILTPDELDSIYRSSELIRKYNQTIDRESAYEILGKKVEAYEREKAEEEARKEWEK… |
| A0A7Z9ZNH0 | 260-379 | RKNPRFITEEKIGNMKVGYALVSNLDKDGAPTIVEHTMMRPPQSRMGVLTDAERNEKIKNSPVYGVYEQKIDNESAFEVLKERAEKK… |
| A0A7K0Q0N5 | 1-155 | None |
| A0A377KE97 | 83-239 | None |
| A0A378FV31 | 17-103 | None |
| A0A7M3M293 | 41-167 | None |
| A0A1V5QLN2 | 237-395 | None |
| A0A1V4UAF9 | 1-150 | None |
| A0A6L5C6B3 | 344-514 | None |
| A0A090Q1X9 | 106-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.