DPCstruct | MC636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 114 ± 24 aa |
| Standard deviation of domain lengths | 23.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2YNK2 | 1-117 | MPLQNRVLPTQEIVADPGRGLLMGNRGTLHGPDLALGTTRWRSKAWICCVLDWKGVQRDPMPTGRWTALFFFDEAVALAAGHRPCAY… |
| A0A1I4PCU4 | 1-132 | MPLQNRVNPKGIIESNSARGTLMGNRGVLHNASKEVTRLFKTKAWITCALEFKGRQRTLMSPGAYTELFFLDEVAAFAAGHRPCVEY… |
| A0A1Q8Y1M5 | 1-115 | None |
| A0A2R8B552 | 1-106 | None |
| A0A7S3AFI3 | 53-228 | None |
| A0A2E5C609 | 2-93 | None |
| A0A7I7UFR5 | 158-234 | None |
| C8XFZ0 | 15-128 | None |
| A0A5R8M697 | 5-128 | None |
| A0A1H8BHZ6 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.