DPCstruct | MC63590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 523 ± 86 aa |
| Standard deviation of domain lengths | 86.36 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 71.83 |
| Assigned Pfam label(s) | CL0198- PF08354- CL0050- PF17951 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8AZ64 | 1-557 | MPIDGILVGTAAMATLESTTSPSVKRMLVETQGTEHWIGAGKAVGGMASSRSQLGADIHEIDNSASRCGRLLDEVAGDAEAVAERRD… |
| A0A2S8BGH0 | 147-559 | LAYGFPLMPVDGILVGTAAMATKEATTSPSVKQMLVETQGTDQWISAGKAQGGMASSRSQLGADIHEIDNTASRCGRLLDEVAGDAE… |
| X8F2H4 | 224-695 | None |
| B8NVJ6 | 299-843 | None |
| A0A401H1S2 | 1-651 | None |
| M2XHU6 | 656-1277 | None |
| A0A1Y1W708 | 679-1101 | None |
| A0A5E3XCX6 | 12-437 | None |
| A0A409Y503 | 130-724 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.