DPCstruct | MC63587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7D6T2 | 11-96 | AFVLNVVLNGKHEVIGSFAGDIHKAHEAGCEFVKSLAGVEPVECEIAITTNGGYPLDQNIYQAVKGMCSAEATLPEGGVIIDVAGC |
| A0A3D0ULI9 | 62-157 | REVALRTQPTFLLNVTLNVDRQITGVFAGDMSAAHAQGCAFVKKQAMVGVNAPYDIVLTTNSGYPLDQNLYQSVKGMSAASQIVRQG… |
| A0A3R6TIW5 | 5-80 | None |
| C9LPD2 | 5-91 | None |
| A0A3D6D8I2 | 33-121 | None |
| X1LJP6 | 171-262 | None |
| A0A7E4SF04 | 897-1001 | None |
| A0A2E3I187 | 1-75 | None |
| A0A4R5JIA9 | 219-303 | None |
| A0A3M1HRH4 | 320-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.